PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G0419
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 310aa    MW: 34939.7 Da    PI: 6.8018
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G0419genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.12.9e-11180225550
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++ 
  Gh_A01G0419 180 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVA 225
                  8999*********************************999987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.1E-14176240IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.703178230IPR004827Basic-leucine zipper domain
PfamPF001708.7E-10180225IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.13E-11180234No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-14180231No hitNo description
CDDcd147033.25E-22181231No hitNo description
PROSITE patternPS000360183198IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MTQNWPSFPH QRLPTMANFI STTANTATMN ASHNHQPSWV DEFLDFSSAR RGAHRRSISD  60
SIAFLEQPLV EECRDSNTNH NNNAMITETN VFDRLDDEQL MSMFSDDVAV TMAAAPTLSS  120
SNPSTPTSDQ NSNNDEKPVP SLDLQQPKNE PGEVESSCKP EPQAAQPPST SNGDPIVDPK  180
RVKRILANRQ SAQRSRVRKL QYISELERSV TTLQTEVSAL SPRVAFLDHQ RLILNVDNSA  240
LKQRIAALAQ DKIFKDAHQE ALKKEIERLR QVYQQQQSLK KMNSNNSNNH HAPPQQQPSQ  300
PQQTKKEEQL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.82030.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012457700.10.0PREDICTED: basic leucine zipper 61-like
SwissprotQ9M2K41e-102BZP61_ARATH; Basic leucine zipper 61
TrEMBLA0A0B0NGA70.0A0A0B0NGA7_G
STRINGVIT_19s0014g01780.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.17e-90bZIP family protein